PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr024765.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 549aa    MW: 59225.9 Da    PI: 4.9916
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr024765.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.7e-173986148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +lv++vk++G g+W+++ ++ g+ R++k+c++rw ++l
      Pbr024765.1 39 KGPWTSAEDAILVEYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 86
                     79******************************************9986 PP

2Myb_DNA-binding53.46e-1792135146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ l+v++++++G++ W++ a++++ gRt++++k++w++
      Pbr024765.1  92 KGAFTPEEERLIVELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 135
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.5933486IPR017930Myb domain
SuperFamilySSF466891.39E-3037133IPR009057Homeodomain-like
SMARTSM007172.1E-153888IPR001005SANT/Myb domain
PfamPF002492.0E-153986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-244093IPR009057Homeodomain-like
CDDcd001676.81E-124186No hitNo description
PROSITE profilePS5129426.71187141IPR017930Myb domain
SMARTSM007173.4E-1791139IPR001005SANT/Myb domain
PfamPF002498.3E-1692135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-2694140IPR009057Homeodomain-like
CDDcd001671.30E-1294135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    Send to blast
MSRTTNESED GVLSKDQIDS PLMDESNGGS GNGGMVLKKG PWTSAEDAIL VEYVKKHGEG  60
NWNAVQKHSG LFRCGKSCRL RWANHLRPNL KKGAFTPEEE RLIVELHAKM GNKWARMAAH  120
LPGRTDNEIK NYWNTRIKRR QRAGLPLYPP EVCLQAFQES QQGQSSGGNN GADREQHDSM  180
QANSFEIPDV VFDSLKGNGC VLPYVPDLPD ISPGGMLMKG LGSAPYCGFM PPTMHRQKRL  240
RESTALFSTS GGSFNQFDQF QSDTCDEVAR TFGLPFPHDP DPTTRSPLSF GVIQGSHSLS  300
NGNSSASKPT SGAVKLELPS LQYPETDLGS WSTSPPPPLL ESIDAFIQSP PQVGTFEPDC  360
TSPRNSGLLD ALLHEAKALS SAKNHSSEKS SNSSSVTPGD VAIGSNLNIC ETEWEERDPI  420
SPLGHSATSM FSECTPISAS GSSLDEPPPA ETFTGCNVKS EPVDQAWAPD KEKEMGLLMD  480
YTRPDAILAS EWFGNGMHES IASLLGDDLA AECKHLASGS PTSDQGLGFS SCPWNTMPPV  540
CQMSAQHP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-33371405107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009355091.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_009355092.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLM5X3T10.0M5X3T1_PRUPE; Uncharacterized protein
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.11e-123myb domain protein 65